Iright
BRAND / VENDOR: Proteintech

Proteintech, 23614-1-AP, MUC1/CA15-3 C-terminal Polyclonal antibody

CATALOG NUMBER: 23614-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MUC1/CA15-3 C-terminal (23614-1-AP) by Proteintech is a Polyclonal antibody targeting MUC1/CA15-3 C-terminal in WB, IHC, ELISA applications with reactivity to human samples 23614-1-AP targets MUC1/CA15-3 C-terminal in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells, PC-3 cells, BxPC-3 cells, MCF-7 cells Positive IHC detected in: human pancreas cancer tissue, human tonsillitis tissue, human breast cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MUC1 is a type I transmembrane glycoprotein expressed by various epithelial cells of the female reproductive tract, lung, breast, kidney, stomach, and pancreas. MUC1 is transcribed as a large precursor gene product, and upon translation, is cleaved in the endoplasmic reticulum, yielding two subunits: the large extracellular N-terminal subunit (MUC1-N, about 120-200 kDa) and the small cytoplasmic C-terminal subunit (MUC1-C, about 23-30 kDa). Among the known mucins, MUC1 is best studied and plays crucial roles in regulating many cellular properties, including cell proliferation, apoptosis, adhesion, and invasion. MUC1 is overexpressed in a wide range of human epithelial malignancies. This antibody was raised against the C-terminal region of human MUC1, thus it recognizes the 23-30 kDa cytoplasmic MUC1. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20366 Product name: Recombinant human CA15-3,MUC1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1055-1255 aa of BC120975 Sequence: NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL Predict reactive species Full Name: mucin 1, cell surface associated Calculated Molecular Weight: 1264 aa, 123 kDa Observed Molecular Weight: 23-28 kDa GenBank Accession Number: BC120975 Gene Symbol: MUC1/CA15-3 Gene ID (NCBI): 4582 RRID: AB_2879304 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15941 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924