Proteintech, 23781-1-AP, ADM2 Polyclonal antibody

Size: 20ul / 150ul The ADM2 (23781-1-AP) by Proteintech is a Polyclonal antibody targeting ADM2 in IHC, ELISA applications with reactivity to human, mouse samples 23781-1-AP targets ADM2 in IF, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human stomach tissue, mouse stomach tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ADM2 also named as adrenomedullin 2 or IMDS is a 148 amino-acid secreted protein, which belongs to adrenomedullin family of calcitonin-related peptide hormones and is expressed in the esophagus, stomach, jejunum, ileum, ileocecum, ascending colon, transverse colon, descending colon and rectum. ADM2 activates the cAMP-dependent pathway and may play a role in regulating gastrointestinal and cardiovascular bioactivities. ADM2 play a role in the regulation of peripheral tissues by calcitonin receptor-like receptor. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20548 Product name: Recombinant human ADM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-148 aa of BC012864 Sequence: MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG Predict reactive species Full Name: adrenomedullin 2 Calculated Molecular Weight: 16 kDa GenBank Accession Number: BC012864 Gene Symbol: ADM2 Gene ID (NCBI): 79924 RRID: AB_2879322 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q7Z4H4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.