Proteintech, 23795-1-AP, PLXNB1 Polyclonal antibody

Size: 20ul / 150ul The PLXNB1 (23795-1-AP) by Proteintech is a Polyclonal antibody targeting PLXNB1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 23795-1-AP targets PLXNB1 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human kidney tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Semaphorins, originally identified as axon guidance molecules, have also been implicated in angiogenesis, immunoregulation, and cancer (PMID: 16584533). Plexins are main receptors for semaphorins and are thought to control many of the functional effects of semaphorins. PLXNB1 is one of the three plexin-B family members. It is a high-affinity receptor for semaphorin 4D (SEMA4D). Interaction of SEMA4D and PLXNB1 has important physiologic effects in the immune and nervous systems, and is also involved in tumor progression, especially in tumor angiogenesis (PMID: 20858260). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20719 Product name: Recombinant human PLXNB1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 20-369 aa of BC146793 Sequence: LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPV Predict reactive species Full Name: plexin B1 Calculated Molecular Weight: 2135 aa, 232 kDa Observed Molecular Weight: 210 kDa GenBank Accession Number: BC146793 Gene Symbol: PLXNB1 Gene ID (NCBI): 5364 RRID: AB_2879326 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: O43157 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.