Iright
BRAND / VENDOR: Proteintech

Proteintech, 23805-1-AP, NRK1 Polyclonal antibody

CATALOG NUMBER: 23805-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NRK1 (23805-1-AP) by Proteintech is a Polyclonal antibody targeting NRK1 in WB, IP, ELISA applications with reactivity to human, mouse samples 23805-1-AP targets NRK1 in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse liver tissue Positive IP detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information NRK1 (Nicotinamide riboside kinase 1) is necessary and rate-limiting for the use of exogenous NR and NMN for NAD þ synthesis. Functionally, NRK1 activity restrains CD4+ T cell activation and cytokine production and promotes survival. These activities are linked to increased NRK1 expression in the cytoplasm, where it locally elevates NAD/H levels (PMID: 27725675, 29678570). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20746 Product name: Recombinant human C9orf95 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-199 aa of BC001366 Sequence: MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSPGYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA Predict reactive species Full Name: chromosome 9 open reading frame 95 Calculated Molecular Weight: 199 aa, 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC001366 Gene Symbol: C9orf95 Gene ID (NCBI): 54981 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9NWW6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924