Iright
BRAND / VENDOR: Proteintech

Proteintech, 23854-1-AP, BCHE Polyclonal antibody

CATALOG NUMBER: 23854-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BCHE (23854-1-AP) by Proteintech is a Polyclonal antibody targeting BCHE in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 23854-1-AP targets BCHE in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information BCHE(butyrylcholinesterase) is an enzyme expressed in most human tissues. It may have a greater role in cholinergic transmission than previously surmised, making BChE inhibition an important therapeutic goal in Alzheimer's disease(PMID:11848688). BCHE is also named as CHE1 and belongs to the type-B carboxylesterase/lipase family. This is a glycoprotein with the molecular weight from 68 kDa to 90 kDa. Specification Tested Reactivity: human Cited Reactivity: human, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20888 Product name: Recombinant human BCHE protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 539-602 aa of BC008396 Sequence: MTKLRAQQCRFWTSFFPKVLEMTGNIDEAEWEWKAGFHRWNNYMMDWKNQFNDYTSKKESCVGL Predict reactive species Full Name: butyrylcholinesterase Calculated Molecular Weight: 602 aa, 68 kDa Observed Molecular Weight: 85-90 kDa GenBank Accession Number: BC008396 Gene Symbol: BCHE Gene ID (NCBI): 590 RRID: AB_2879341 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P06276 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924