Proteintech, 23866-1-AP, ATP5SL Polyclonal antibody

Size: 20ul / 150ul The ATP5SL (23866-1-AP) by Proteintech is a Polyclonal antibody targeting ATP5SL in WB, ELISA applications with reactivity to human samples 23866-1-AP targets ATP5SL in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20909 Product name: Recombinant human ATP5SL protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-158 aa of BC013323 Sequence: MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLLQREMYKVHEKNRFRDKEWIRPDKYGHFSQEFWNFCEVPVEAVDAGDCDINYEGLDNLRTSAGWTSRTSLPCPTLASLRYWWRRCCPIARLWESTGLRA Predict reactive species Full Name: ATP5S-like Calculated Molecular Weight: 158 aa, 19 kDa Observed Molecular Weight: 29-32 kDa GenBank Accession Number: BC013323 Gene Symbol: ATP5SL Gene ID (NCBI): 55101 RRID: AB_3669421 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9NW81 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.