Proteintech, 23881-1-AP, Alpha Internexin Polyclonal antibody

Size: 20ul / 150ul The Alpha Internexin (23881-1-AP) by Proteintech is a Polyclonal antibody targeting Alpha Internexin in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 23881-1-AP targets Alpha Internexin in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: human pancreas cancer tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20844 Product name: Recombinant human INA protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-300 aa of BC006359 Sequence: MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR Predict reactive species Full Name: internexin neuronal intermediate filament protein, alpha Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 66-68 kDa GenBank Accession Number: BC006359 Gene Symbol: INA Gene ID (NCBI): 9118 RRID: AB_2879348 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16352 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.