Iright
BRAND / VENDOR: Proteintech

Proteintech, 23892-1-AP, N4BP2 Polyclonal antibody

CATALOG NUMBER: 23892-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The N4BP2 (23892-1-AP) by Proteintech is a Polyclonal antibody targeting N4BP2 in WB, IHC, ELISA applications with reactivity to human, rat samples 23892-1-AP targets N4BP2 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, K-562 cells Positive IHC detected in: rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information N4BP2 (Nedd4 binding protein 2) is a Bcl-3 binding protein, which contains a polynucleotide kinase domain (PNK) at the N-terminus and a Small MutS Related (Smr) domain with nicking endonuclease activity near C-terminus. N4BP2 was at higher levels in a majority of tumor tissues examined, relative to paired normal tissues (PMID: 17626640). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20943 Product name: Recombinant human N4BP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1426-1770 aa of BC126466 Sequence: SVMERQRQEEVSCGKFMQDPSLVGHTGLDNPEQKSSQRTGKKLLKTLTASEMLPLLDHWNTQTKKVSLREIMSEEIALQEKHNLKRETLMFEKDCATKLKEKQLFKIFPAINQNFLVDIFKDHNYSLEHTVQFLNCVLEGDPVKTVVAQEFVHQNENVTSHTGQKSKEKKPKKLKETEETPSELSFQDFEYPDYDDYRAEAFLHQQKRMECYSKAKEAYRIGKKNVATFYAQQGTLHEQKMKEANHLAAIEIFEKVNASLLPQNVLDLHGLHVDEALEHLMRVLEKKTEEFKQNGGKPYLSVITGRGNHSQGGVARIKPAVIKYLISHSFRFSEIKPGCLKVMLK Predict reactive species Full Name: NEDD4 binding protein 2 Calculated Molecular Weight: 1770 aa, 199 kDa Observed Molecular Weight: 199 kDa GenBank Accession Number: BC126466 Gene Symbol: N4BP2 Gene ID (NCBI): 55728 RRID: AB_3669422 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q86UW6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924