Iright
BRAND / VENDOR: Proteintech

Proteintech, 23897-1-AP, BTBD8 Polyclonal antibody

CATALOG NUMBER: 23897-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BTBD8 (23897-1-AP) by Proteintech is a Polyclonal antibody targeting BTBD8 in WB, ELISA applications with reactivity to human samples 23897-1-AP targets BTBD8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information BTBD8, also named as BTB/POZ domain-containing protein 8, is a 378 amino acid protein, which is highly expressed in fetal brain and localizes in the nucleus. BTBD8 exists two isoforms and the molecular weight of isoforms are 43 kDa and 35 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20960 Product name: Recombinant human BTBD8 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-378 aa of BC013922 Sequence: MARCGEGSAAPMVLLGSAGVCSKGLQRKGPCERRRLKATVSEQLSQDLLRLLREEFHTDVTFSVGCTLFKAHKAVLLARVPDFYFHTIGQTSNSLTNQEPIAVENVEALEFRTFLQIIYSSNRNIKNYEEEILRKKIMEIGISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFISNDNYDLEPASELGEDLLKLYVKPGCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVMMHFIYGGTLDIPDKTNVGQILNMADMYGLEGLKEVAIYILRRDYCNFFQKPVPRTLTSILECLIIAHSVGVESLFADCMKWIVKHFARFWSERSFANIPPEIQKSCLNMLIQSLVNIT Predict reactive species Full Name: BTB (POZ) domain containing 8 Calculated Molecular Weight: 278 aa, 43 kDa Observed Molecular Weight: 43 kDa, 34 kDa GenBank Accession Number: BC013922 Gene Symbol: BTBD8 Gene ID (NCBI): 284697 RRID: AB_2879353 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9UPP5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924