Proteintech, 23910-1-AP, AKR1D1 Polyclonal antibody

Size: 20ul / 150ul The AKR1D1 (23910-1-AP) by Proteintech is a Polyclonal antibody targeting AKR1D1 in WB, ELISA applications with reactivity to human, mouse, rat samples 23910-1-AP targets AKR1D1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information AKR1D1 (steroid 5β-reductase) reduces all Δ 4-3-ketosteroids to form 5β-dihydrosteroids, a first step in the clearance of steroid hormones and an essential step in the synthesis of all bile acids. It is also named as SRD5B1 and belongs to the aldo/keto reductase family. This protein has 3 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21009 Product name: Recombinant human AKR1D1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 209-326 aa of BC130627 Sequence: CQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY Predict reactive species Full Name: aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) Calculated Molecular Weight: 326 aa, 37 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC130627 Gene Symbol: AKR1D1 Gene ID (NCBI): 6718 RRID: AB_2879359 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P51857 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.