Product Description
Size: 20ul / 150ul
The TMEM150 (23912-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM150 in WB, ELISA applications with reactivity to human, mouse, rat samples
23912-1-AP targets TMEM150 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: Jurkat cells, mouse colon tissue, rat colon tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag21019 Product name: Recombinant human TMEM150 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 222-271 aa of BC050466 Sequence: YGTFSYEFGAVSSDTLVAALQPTPGRACKSSGSSSTSTHLNCAPESIAMI Predict reactive species
Full Name: transmembrane protein 150
Calculated Molecular Weight: 271 aa, 29 kDa
Observed Molecular Weight: 33 kDa
GenBank Accession Number: BC050466
Gene Symbol: TMEM150
Gene ID (NCBI): 129303
RRID: AB_3669424
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen Affinity purified
UNIPROT ID: Q86TG1
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924