Iright
BRAND / VENDOR: Proteintech

Proteintech, 23940-1-AP, MTTP/MTP Polyclonal antibody

CATALOG NUMBER: 23940-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MTTP/MTP (23940-1-AP) by Proteintech is a Polyclonal antibody targeting MTTP/MTP in WB, ELISA applications with reactivity to human, mouse, rat samples 23940-1-AP targets MTTP/MTP in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse small intestine tissue, rat liver tissue, rat small intestine tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information MTTP, also known as MTP, belongs to the lipid transfer protein family and forms a heterodimeric complex with protein disulfide isomerase (PDI) to perform lipid transfer functions. MTTP is isolated as a soluble protein from the lumen of a microsomal fraction of liver and intestine. MTTP assembles triglycerides and apoB in the liver and intestine and subsequently produces apoB-containing lipoproteins. Deficiency in MTTP can cause abetalipoproteinemia, characterized by the absence of apoB-containing lipoproteins from the circulatory system(PMID: 10946006, 23475612). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21045 Product name: Recombinant human MTTP protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-151 aa of BC062696 Sequence: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGKLQDSVGYRISSNVDVALLWRNPDGDDDQLIQITMKDVNVENVNQQRGEKSIFKGKSPSKIMGKENLEALQRPTLLHLIHGKVKGRLDSTTFSPTSYFSSLQ Predict reactive species Full Name: microsomal triglyceride transfer protein Calculated Molecular Weight: 151aa,17 kDa; 894aa,99 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: BC062696 Gene Symbol: MTTP Gene ID (NCBI): 4547 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: P55157 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924