Iright
BRAND / VENDOR: Proteintech

Proteintech, 23967-1-AP, G6PC3 Polyclonal antibody

CATALOG NUMBER: 23967-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The G6PC3 (23967-1-AP) by Proteintech is a Polyclonal antibody targeting G6PC3 in IHC, ELISA applications with reactivity to human samples 23967-1-AP targets G6PC3 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21103 Product name: Recombinant human G6PC3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 226-346 aa of BC021574 Sequence: WSISLAFKWCERPEWIHVDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAQLGNGQKIACLVLAMGLLGPLDWLGHPPQISLFYIFNFLKYTLWPCLVLALVPWAVHMFSAQEAPPIHSS Predict reactive species Full Name: glucose 6 phosphatase, catalytic, 3 Calculated Molecular Weight: 346 aa, 39 kDa GenBank Accession Number: BC021574 Gene Symbol: G6PC3 Gene ID (NCBI): 92579 RRID: AB_2879380 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9BUM1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924