Iright
BRAND / VENDOR: Proteintech

Proteintech, 23993-1-AP, ATPBD4 Polyclonal antibody

CATALOG NUMBER: 23993-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATPBD4 (23993-1-AP) by Proteintech is a Polyclonal antibody targeting ATPBD4 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 23993-1-AP targets ATPBD4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells, L02 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Diphthamide is a highly modified histidine in the transcription factor EEF2 that is conserved from yeast to human. ATPBD4, also known as DPH6, belongs to the Diphthine--ammonia ligase family. DPH6 amidase may catalyze the last step of diphthamide biosynthesis using ammonium and ATP to play a role in catalyzing the final step of diphthamide biosynthesis, amidation of diphthine to diphthamide (PubMed:23169644). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21178 Product name: Recombinant human ATPBD4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-259 aa of BC008485 Sequence: GGKDSCYNMMQCIAAGHQIVALANLRPAENQVGSDELDSYMYQTVGHHAIDLYAEAMALPLYRRTIRGRSLDTRQVYTKCEGDEVEDLYELLKLVKEKEEVEGISVGAILSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQAMIIKVAALGLDPDKHLGKTLDQMEPYLIELSKKYGVHVCGEGGEYETFTLDCPLFKKKIIVDSSEVVIHSADAFAPVAYLRFLELHLEDKVSSVPDNYRTSNYIYNF Predict reactive species Full Name: ATP binding domain 4 Calculated Molecular Weight: 267 aa, 30 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC008485 Gene Symbol: ATPBD4 Gene ID (NCBI): 89978 RRID: AB_2879392 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L8W6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924