Proteintech, 24025-1-AP, GALNT8 Polyclonal antibody

Size: 20ul / 150ul The GALNT8 (24025-1-AP) by Proteintech is a Polyclonal antibody targeting GALNT8 in WB, ELISA applications with reactivity to human samples 24025-1-AP targets GALNT8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, MCF-7 cells, SH-SY5Y cells, Y79 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information GALNT8 (Probable polypeptide N-acetylgalactosaminyltransferase 8) is a member of the UDP-GalNAc polypeptide N-acetylgalactosaminyl transferase (ppGaNTase) family, which initiates mucin-like O-linked protein glycosylation in the Golgi apparatus. The tissue distribution of GALNT8 is high in the heart, skeletal muscle, kidney and liver; moderate in the placenta, small intestine, leukocyte and lung; and weak in the brain, colon, thymus and spleen (PMID: 34576978). The overexpression of GALNT8 significantly promotes the cell cycle and proliferation of CRC cell lines and correlates with poor prognosis in patients with CRC. GALNT8 encodes a 637-amino-acid type-II membrane protein (GalNAc-T8). The detected molecular weight of GALNT8 (95 kDa) is much higher than the theoretical molecular weight (70 kDa) due to three N-GlcNAc sites (N85, N107 and N160) (PMID: 34743989, 34239555). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21185 Product name: Recombinant human GALNT8 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 522-637 aa of BC140889 Sequence: MYYCHEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDPGKAEKPTLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCLEMKKDLLGSHVLVLQTCSTQVWEIQHTVRDWGQTNSQ Predict reactive species Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 8 (GalNAc-T8) Calculated Molecular Weight: 637 aa, 73 kDa Observed Molecular Weight: 73 kDa, 95 kDa GenBank Accession Number: BC140889 Gene Symbol: GALNT8 Gene ID (NCBI): 26290 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NY28 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.