Product Description
Size: 20ul / 150ul
The GALNT8 (24025-1-AP) by Proteintech is a Polyclonal antibody targeting GALNT8 in WB, ELISA applications with reactivity to human samples
24025-1-AP targets GALNT8 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HCT 116 cells, MCF-7 cells, SH-SY5Y cells, Y79 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Background Information
GALNT8 (Probable polypeptide N-acetylgalactosaminyltransferase 8) is a member of the UDP-GalNAc polypeptide N-acetylgalactosaminyl transferase (ppGaNTase) family, which initiates mucin-like O-linked protein glycosylation in the Golgi apparatus. The tissue distribution of GALNT8 is high in the heart, skeletal muscle, kidney and liver; moderate in the placenta, small intestine, leukocyte and lung; and weak in the brain, colon, thymus and spleen (PMID: 34576978). The overexpression of GALNT8 significantly promotes the cell cycle and proliferation of CRC cell lines and correlates with poor prognosis in patients with CRC. GALNT8 encodes a 637-amino-acid type-II membrane protein (GalNAc-T8). The detected molecular weight of GALNT8 (95 kDa) is much higher than the theoretical molecular weight (70 kDa) due to three N-GlcNAc sites (N85, N107 and N160) (PMID: 34743989, 34239555).
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag21185 Product name: Recombinant human GALNT8 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 522-637 aa of BC140889 Sequence: MYYCHEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDPGKAEKPTLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCLEMKKDLLGSHVLVLQTCSTQVWEIQHTVRDWGQTNSQ Predict reactive species
Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 8 (GalNAc-T8)
Calculated Molecular Weight: 637 aa, 73 kDa
Observed Molecular Weight: 73 kDa, 95 kDa
GenBank Accession Number: BC140889
Gene Symbol: GALNT8
Gene ID (NCBI): 26290
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NY28
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924