Proteintech, 24063-1-AP, DR4 Polyclonal antibody

Size: 20ul / 150ul The DR4 (24063-1-AP) by Proteintech is a Polyclonal antibody targeting DR4 in WB, ELISA applications with reactivity to human samples 24063-1-AP targets DR4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Jurkat cells, HeLa cells, PC-3 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Tumor necrosis factor (TNF)-related apoptosis-inducing ligand (TRAIL) is a member of the TNF superfamily. TRAIL activates apoptosis through the death receptors DR4 (also known as TRAILR1 and TNFRSF10A) and DR5 (also known as TRAILR2, KILLER and TNFRSF10B). DR4 and DR5 are single-pass type I membrane proteins that contain intracellular death domains (DD) and upon activation mediate apoptotic signals (PMID: 11163110). Binding of TRAIL to DR4 or DR5 results in receptor oligomerization and recruitment of FAS-associated protein with death domain (FADD) and caspase 8 to form a functional death-inducing signalling complex (DISC). Upon DISC formation, caspase 8 is cleaved and activated, which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis (PMID: 18813321). DR4 or DR5 promotes the activation of NF-kappa-B and play an important role in inflammation (PMID: 9430227, 19434100). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20927 Product name: Recombinant human DR4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 261-468 aa of BC012866 Sequence: CCCIGSGCGGDPKCMDRVCFWRLGLLRGPGAEDNAHNEILSNADSLSTFVSEQQMESQEPADLTGVTVQSPGEAQCLLGPAEAEGSQRRRLLVPANGADPTETLMLFFDKFANIVPFDSWDQLMRQLDLTKNEIDVVRAGTAGPGDALYAMLMKWVNKTGRNASIHTLLDALERMEERHAKEKIQDLLVDSGKFIYLEDGTGSAVSLE Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 10a Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 37-55 kDa GenBank Accession Number: BC012866 Gene Symbol: DR4 Gene ID (NCBI): 8797 RRID: AB_2879421 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00220 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.