Iright
BRAND / VENDOR: Proteintech

Proteintech, 24066-1-AP, SLC36A4 Polyclonal antibody

CATALOG NUMBER: 24066-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC36A4 (24066-1-AP) by Proteintech is a Polyclonal antibody targeting SLC36A4 in WB, ELISA applications with reactivity to human samples 24066-1-AP targets SLC36A4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information SLC36A4 (also known as proton-coupled amino-acid transporter 4, PAT4), is a member of the solute carrier (SLC) 36 family which functions as transporter for amino acids and derivatives. SLC36A4 is widely distributed at the mRNA level in normal tissues and many cancer cell lines. It modulates the mTORC1 signaling and is essential for the proliferation of cancer cells. In addition, small GTPase Rab12 controls the degradation of SLC36A4, which indirectly modulates mTORC1 activity and autophagy. This antibody can recognize the endogenous SLC36A4 protein in multiple cell lines. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21142 Product name: Recombinant human SLC36A4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-207 aa of BC047374 Sequence: MEAAATPAAAGAARREELDMDVMRPLINEQNFDGTSDEEHEQELLPVQKHYQLDDQEGISFVQTLMHLLKGNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCLRFKKSTLGYSDTVSFAMEVSPWSCLQKQAAWGRSVVDFFLVITQLGFCSVYIVFLAENVKQVHEGFLESKVFISNSTNSSNPCERRSV Predict reactive species Full Name: solute carrier family 36 (proton/amino acid symporter), member 4 Calculated Molecular Weight: 504 aa, 56 kDa Observed Molecular Weight: 41-66 kDa GenBank Accession Number: BC047374 Gene Symbol: SLC36A4 Gene ID (NCBI): 120103 RRID: AB_2879424 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q6YBV0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924