Proteintech, 24069-1-AP, ITIH4 Polyclonal antibody

Size: 20ul / 150ul The ITIH4 (24069-1-AP) by Proteintech is a Polyclonal antibody targeting ITIH4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24069-1-AP targets ITIH4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human plasma, mouse lung tissue, mouse serum, rat serum Positive IHC detected in: human hepatocirrhosis tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ITIH4(Inter-alpha-trypsin inhibitor heavy chain H4) is a liver-restricted plasma glycoprotein belonging to the serine protease inhibitor family, playing diverse roles in inflammation, extracellular matrix (ECM) stabilization, and cancer progression. Expressed mainly in hepatocytes, ITIH4 is secreted into the bloodstream, where it can be cleaved by plasma kallikrein into specific fragments. Functionally, ITIH4 acts as an anti-apoptotic and matrix-stabilizing molecule during liver development and regeneration, with its expression regulated by interleukin-6 (IL-6). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21275 Product name: Recombinant human ITIH4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 622-932 aa of BC136393 Sequence: STFFKYYLQGAKIPKPEASFSPRRGWNRQAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPFRRLAILPASATPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL Predict reactive species Full Name: inter-alpha (globulin) inhibitor H4 (plasma Kallikrein-sensitive glycoprotein) Calculated Molecular Weight: 103 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC136393 Gene Symbol: ITIH4 Gene ID (NCBI): 3700 RRID: AB_2879426 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q14624 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.