Proteintech, 24137-1-AP, ZMAT4 Polyclonal antibody

Size: 20ul / 150ul The ZMAT4 (24137-1-AP) by Proteintech is a Polyclonal antibody targeting ZMAT4 in WB, ELISA applications with reactivity to human, mouse samples 24137-1-AP targets ZMAT4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Zinc finger protein 4 (ZMAT4) is a member of the zinc finger (ZNF) family and has two isoforms. It is normally found in the nucleus and is associated with DNA binding, metal ion binding and zinc ion binding. The copy number variation (CNV) of its depository ZMAT4 has the potential to be used as a diagnostic indicator of hematologic malignancies, either alone or in combination with other markers. ( PMID: 21269563) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21346 Product name: Recombinant human ZMAT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-153 aa of BC019598 Sequence: LLLGEKTPLKTTGLRRNYRCAICSVSLNSIEQYHAHLKGSKHQTNLKNK Predict reactive species Full Name: zinc finger, matrin type 4 Calculated Molecular Weight: 229 aa, 26 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC019598 Gene Symbol: ZMAT4 Gene ID (NCBI): 79698 RRID: AB_3085724 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q9H898 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.