Proteintech, 24228-1-AP, FLYWCH2 Polyclonal antibody

Size: 20ul / 150ul The FLYWCH2 (24228-1-AP) by Proteintech is a Polyclonal antibody targeting FLYWCH2 in IHC, ELISA applications with reactivity to human samples 24228-1-AP targets FLYWCH2 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human thyroid cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FLYWCH2 (FLYWCH Family Member 2) is a Protein Coding gene. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21577 Product name: Recombinant human FLYWCH2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 50-140 aa of BC014089 Sequence: DSTKVAGAKRKGVHCVMSLGVPGPATLAKALLQTHPEAQRAIEAAPQEPEQKRSRQDPGTDRTEDSGLAAGPPEAAGENFAPCSVAPGKSL Predict reactive species Full Name: FLYWCH family member 2 Calculated Molecular Weight: 140 aa, 15 kDa GenBank Accession Number: BC014089 Gene Symbol: FLYWCH2 Gene ID (NCBI): 114984 RRID: AB_3085728 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen Affinity purified UNIPROT ID: Q96CP2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.