Iright
BRAND / VENDOR: Proteintech

Proteintech, 24286-1-AP, FAM71F2 Polyclonal antibody

CATALOG NUMBER: 24286-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM71F2 (24286-1-AP) by Proteintech is a Polyclonal antibody targeting FAM71F2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 24286-1-AP targets FAM71F2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, mouse liver tissue Positive IF/ICC detected in: PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16874 Product name: Recombinant human FAM71F2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 179-300 aa of BC105730 Sequence: KFTHCLVPKMPTNSTETTPENSLLSSPQPSEPLVLLAAEQTSGSFSQLSGKPQLTADRNNDTAIEIDNCSSYKIPSPVASPINLNIPMRAALSHSLWEQEDWNEHLLQVHIASYLGEHFLGA Predict reactive species Full Name: family with sequence similarity 71, member F2 Calculated Molecular Weight: 309 aa, 35 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC105730 Gene Symbol: FAM71F2 Gene ID (NCBI): 346653 RRID: AB_2879473 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6NXP2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924