Iright
BRAND / VENDOR: Proteintech

Proteintech, 24288-1-AP, MIF4GD Polyclonal antibody

CATALOG NUMBER: 24288-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MIF4GD (24288-1-AP) by Proteintech is a Polyclonal antibody targeting MIF4GD in WB, IHC, ELISA applications with reactivity to human, mouse samples 24288-1-AP targets MIF4GD in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MIF4GD (MIF4G domain containing), also known as MIFD, AD023, or SLIP1, is a 222 amino acid protein that contains one MIF4G domain. Localized to both the nucleus and the cytoplasm, MIF4GD plays a role in the replication-dependent translation of histone mRNAs, which differ from most eukaryotic mRNAs in that they end with a stem-loop instead of a poly-A tail. Specifically, MIF4GD interacts with SLBP, eIF4G and DAP-5. Via its interaction with SLBP, MIF4GD is thought to be tethered to the stem loops of histone mRNAs where it may facilitate the circularizing of the mRNAs, thereby enhancing their translation. Depletion of MIF4GD results in reduced histone translation and may lead to cell death, suggesting that MIF4GD plays an important role in cell survival. Two isoforms of MIF4GD exist due to alternative splicing events. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17931 Product name: Recombinant human MIF4GD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-256 aa of BC033759 Sequence: EPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD Predict reactive species Full Name: MIF4G domain containing Calculated Molecular Weight: 256 aa, 29 kDa Observed Molecular Weight: ~25 kDa GenBank Accession Number: BC033759 Gene Symbol: MIF4GD Gene ID (NCBI): 57409 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A9UHW6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924