Proteintech, 24309-1-AP, MYLK4 Polyclonal antibody

Size: 20ul / 150ul The MYLK4 (24309-1-AP) by Proteintech is a Polyclonal antibody targeting MYLK4 in WB, IP, IHC, ELISA applications with reactivity to human samples 24309-1-AP targets MYLK4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, L02 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human heart tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information MYLK4(Myosin light chain kinase family member 4) is also named as SGK085 and belongs to the CAMK Ser/Thr protein kinase family. MLCKs are activated by Ca2+-calmodulin complexes and require Mg2+ or Ca2+ as a co-factor. It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19314 Product name: Recombinant human MYLK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-110 aa of BC132831 Sequence: VKRLEEFNTCYNSNQLEKMAFFQCREEVEKVKCFLEKNSGDQDSRSRHNEAKEVWSNADLTERMPVKSKRTSALAVDIPAPPAPFDHRIVTAKQGAVNSFYTVSKTE Predict reactive species Full Name: myosin light chain kinase family, member 4 Calculated Molecular Weight: 388 aa, 45 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC132831 Gene Symbol: MYLK4 Gene ID (NCBI): 340156 RRID: AB_2877632 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86YV6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.