Iright
BRAND / VENDOR: Proteintech

Proteintech, 24311-1-AP, KDM2A Polyclonal antibody

CATALOG NUMBER: 24311-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KDM2A (24311-1-AP) by Proteintech is a Polyclonal antibody targeting KDM2A in WB, IP, ELISA applications with reactivity to human, mouse samples 24311-1-AP targets KDM2A in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, NIH/3T3 cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information KDM2A(Lysine-specific demethylase 2A) is also named as CXXC8, FBL7, FBXL11, JHDM1A, KIAA1004 and belongs to the JHDM1 histone demethylase family. It is required to maintain the heterochromatic state, and playing a role in epigenetic silencing. KDM2A is one of the four subunits of the E3 ubiquitin protein ligase complex (SCF) with SKP1, CUL1, RBX1, Fbox protein bringing ubiquitin conjugating enzymes to substrates recruited by F-box. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19448 Product name: Recombinant human KDM2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 374-558 aa of BC064360 Sequence: DEEAVDREPRRLSSRRSVLTSPVANGVNLDYDGLGKTCRSLPSLKKTLAGDSSSDCSRGSHNGQVWDPQCAPRKDRQVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELANSDPKLALTGVPIVQWPKRDKLKFPTRPKVRVPTIPITKPHTMKPAPRLTPVRPAAAS Predict reactive species Full Name: lysine (K)-specific demethylase 2A Calculated Molecular Weight: 1162 aa, 133 kDa Observed Molecular Weight: 126 kDa GenBank Accession Number: BC064360 Gene Symbol: KDM2A Gene ID (NCBI): 22992 RRID: AB_2879488 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2K7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924