Proteintech, 24321-1-AP, FXI Polyclonal antibody

Size: 20ul / 150ul The FXI (24321-1-AP) by Proteintech is a Polyclonal antibody targeting FXI in WB, ELISA applications with reactivity to human, rat samples 24321-1-AP targets FXI in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Factor XI (FXI) is the zymogen of a blood coagulation protease, factor XIa (FXIa), that contributes to hemostasis by activating factor IX. Factor XI is a precursor of an S1 serine protease found in blood plasma. When activated to FXIa, it plays a crucial role in forming and stabilizing fibrin by triggering the activation of factor IX (PMID: 38545505). FXI has 2 isoforms with the molecular mass of 70 kDa and 64 kDa. Isoform 2 is produced by platelets and megakaryocytes but absent from other blood cells. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18004 Product name: Recombinant human F11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 58-397 aa of BC119014 Sequence: LFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHRNICLLKHTQTGTPTRITKLDKVVSGFSLKSCALSNLACIRDIFPNTVFADSNIDSVMAPDAFVCGRICTHHPGCLFFTFFSQEWPKESQRNLCLLKTSESGLPSTRIKKSKALSGFSLQSCRHSIPVFCHSSFYHDTDFLGEELDIVAAKSHEACQKLCTNAVRCQFFTYTPAQASCNEGKGKCYLKLSSNGSPTKILHGRGGISGYTLRLCKMDNECTTKIKPRIVGGTASVRG Predict reactive species Full Name: coagulation factor XI Calculated Molecular Weight: 625 aa, 70 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC119014 Gene Symbol: F11 Gene ID (NCBI): 2160 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P03951 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.