Iright
BRAND / VENDOR: Proteintech

Proteintech, 24327-1-AP, SGLT3/SLC5A4 Polyclonal antibody

CATALOG NUMBER: 24327-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SGLT3/SLC5A4 (24327-1-AP) by Proteintech is a Polyclonal antibody targeting SGLT3/SLC5A4 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 24327-1-AP targets SGLT3/SLC5A4 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information SLC5A4, also known as SGLT3, is a sugar sensor that depolarizes the plasma membrane in response to external glucose (PMID: 12748858, 20421923). SGLT3 mediates the influx of sodium ions into the cell but does not transport sugars, also potently activated by imino sugars such as deoxynojirimycin (PMID: 22766068, 13130073). SGLT3 is a plasma membrane protein, shares 70% identity with SGLT1, and is expressed in the small intestine (cholinergic neurons), skeletal muscle, kidney, uterus, and testis (PMID: 12748858). SGLT3 protein at apparent molecular masses of 72 kDa and 80 kDa in human kidney tissue and HK-2 cells (PMID: 22766068). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19391 Product name: Recombinant human SLC5A4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 579-633 aa of BC153069 Sequence: SQEETDDGVEEDYPEKSRGCLKKAYDLFCGLQKGPKLTKEEEEALSKKLTDTSER Predict reactive species Full Name: solute carrier family 5 (low affinity glucose cotransporter), member 4 Calculated Molecular Weight: 659 aa, 72 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: BC153069 Gene Symbol: SGLT3 Gene ID (NCBI): 6527 RRID: AB_2650519 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NY91 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924