Iright
BRAND / VENDOR: Proteintech

Proteintech, 24383-1-AP, Shootin 1 Polyclonal antibody

CATALOG NUMBER: 24383-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Shootin 1 (24383-1-AP) by Proteintech is a Polyclonal antibody targeting Shootin 1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24383-1-AP targets Shootin 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, Neuro-2a cells, SK-N-SH cells Positive IHC detected in: human bowen diseaseNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Shootin 1, also known as SHTN1, KIAA1598, contains 3 coiled-coil domains and a proline-rich region. Shootin 1 is involved in generating internal asymmetric signals required for neuronal during stages 2 and 3. Shootin 1 plays a role in cytoskeletal organization by regulating the subcellular localization of phosphoinositide 3-kinase (PI3K) activity at the axonal growth cone. SHTN1 produces 2 splice variants, a short variant, SHTN1S, that lacks exons 15 and 16, and a long variant, SHTN1L, that includes exons 1 through 17(PMID: 17030985, 30733148). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18294 Product name: Recombinant human KIAA1598 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 834-1066 aa of BC022348 Sequence: TEEVTDLKRQAVEEMMDRIKKGVHLRPVNQTARPKTKPESSKGCESAVDELKGILGTLNKSTSSRSLKSLDPENSETELERILRRRKVTAEADSSSPTGILATSESKSMPVLGSVSSVTKTALNKKTLEAEFNSPSPPTPEPGEGPRKLEGCTSSKVTFQPPSSIGCRKKYIDGEKQAEPVVVLDPVSTHEPQTKDQVAEKDPTQHKEDEGEIQPENKEDSIENVRETDSSNC Predict reactive species Full Name: KIAA1598 Calculated Molecular Weight: 72 kDa Observed Molecular Weight: 60-80 kDa GenBank Accession Number: BC022348 Gene Symbol: Shootin 1 Gene ID (NCBI): 57698 RRID: AB_2879517 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A0MZ66 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924