Proteintech, 24385-1-AP, ESYT2 Polyclonal antibody

Size: 20ul / 150ul The ESYT2 (24385-1-AP) by Proteintech is a Polyclonal antibody targeting ESYT2 in WB, IHC, ELISA applications with reactivity to human samples 24385-1-AP targets ESYT2 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells, LNCaP cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information ESYT2, also named FAM62B, one of the three-member family of Extended Synaptotagmins that were recently shown to be implicated in the formation of endoplasmic reticulum (ER)-plasma membrane (PM) junctions and in the Ca(2+) dependent regulation of these junctions. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20420 Product name: Recombinant human FAM62B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 559-773 aa of BC013957 Sequence: NPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEKRERPPDHQHSAQVKRPSVSKEGRKTSIKSHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEKAQPPEAGPQGLHDLGRSSSSLLASPGHISVKEPTPSIASDISLPIATQELRQRL Predict reactive species Full Name: family with sequence similarity 62 (C2 domain containing) member B Calculated Molecular Weight: 921 aa, 102 kDa Observed Molecular Weight: 90-100 kDa GenBank Accession Number: BC013957 Gene Symbol: ESYT2 Gene ID (NCBI): 57488 RRID: AB_2879519 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A0FGR8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.