Iright
BRAND / VENDOR: Proteintech

Proteintech, 24395-1-AP, MLK4 Polyclonal antibody

CATALOG NUMBER: 24395-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MLK4 (24395-1-AP) by Proteintech is a Polyclonal antibody targeting MLK4 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 24395-1-AP targets MLK4 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IF/ICC detected in: C6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information MLK4 belongs to the MAP kinase kinase kinase subfamily. The MLK family members are characterized by the presence of signature sequences ofSer/Thr and Tyr kinases within their catalytic domain. The MLK1-4 contains an aminoterminal Src-Homology (SH3) domain, followed by the kinase domain, a leucine-zipper region, and a Cdc42/Rac-interactive binding (CRIB) motif. MLK4 expressed in two splicing variants, MLK4α and MLK4β. The difference of these two isoforms is located in their C-terminal portion. The negative effect of MLK4 on LPS-induced ERK and JNK activation could be very important in controlling the level of cytokine expression, and thus maintaining the balance of inflammatory responses.(PMID:21602844). This protein has 3 isoforms produced by alternative splicing with the molecular weight of 63 kDa, 113 kDa, 53 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18904 Product name: Recombinant human KIAA1804 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 689-1036 aa of BC136649 Sequence: WEEAASANAATVSIEMTPTNSLSRSPQRKKTESALYGCTVLLASVALGLDLRELHKAQAAEEPLPKEEKKKREGIFQRASKSRRSASPPTSLPSTCGEASSPPSLPLSSALGILSTPSFSTKCLLQMDSEDPLVDSAPVTCDSEMLTPDFCPTAPGSGREPALMPRLDTDCSVSRNLPSSFLQQTCGNVPYCASSKHRPSHHRRTMSDGNPTPTGATIISATGASALPLCPSPAPHSHLPREVSPKKHSTVHIVPQRRPASLRSRSDLPQAYPQTAVSQLAQTACVVGRPGPHPTQFLAAKERTKSHVPSLLDADVEGQSRDYTVPLCRMRSKTSRPSIYELEKEFLS Predict reactive species Full Name: mixed lineage kinase 4 Calculated Molecular Weight: 1036 aa, 114 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC136649 Gene Symbol: MLK4 Gene ID (NCBI): 84451 RRID: AB_2879522 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5TCX8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924