Proteintech, 24412-1-AP, ATG14/Barkor (C-terminal) Polyclonal antibody

Size: 20ul / 150ul The ATG14/Barkor (C-terminal) (24412-1-AP) by Proteintech is a Polyclonal antibody targeting ATG14/Barkor (C-terminal) in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 24412-1-AP targets ATG14/Barkor (C-terminal) in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, HeLa cells Positive IHC detected in: human brain tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Barkor, also named as ATG14, Atg14L and KIAA0831, is named as Beclin 1-associated autophagy-related key regulator protein. The function of Barkor in autophagy has been manifested in several assays, including stress-induced LC3 lipidation, autophagosome formation, and Salmonella typhimurium amplification. A major band around 65-68 kDa and a light band around 42 kDa can be observed in western blot which may be caused by alternative splicing of ATG14. The specificity of ATG14 antibody has been tested by siRNA test. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19707 Product name: Recombinant human Barkor protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 152-406 aa of BC109090 Sequence: YSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHILELTSVIFPIEEVKTGVRDPADVSSESDSAMTSSTVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYSWVEEKKTTQGPDMEQSNPAYTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKKLNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESME Predict reactive species Full Name: KIAA0831 Calculated Molecular Weight: 492 aa, 55 kDa Observed Molecular Weight: 65-68 kDa, 42 kDa GenBank Accession Number: BC109090 Gene Symbol: ATG14 Gene ID (NCBI): 22863 RRID: AB_2879531 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZNE5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.