Proteintech, 24423-1-AP, SPAG9 Polyclonal antibody

Size: 20ul / 150ul The SPAG9 (24423-1-AP) by Proteintech is a Polyclonal antibody targeting SPAG9 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 24423-1-AP targets SPAG9 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, RAW 264.7 cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19763 Product name: Recombinant human SPAG9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 199-273 aa of BC146755 Sequence: ERPISLGIFPLPAGDGLLTPDAQKGGETPGSEQWKFQELSQPRSHTSLKVSNSPEPQKAVEQEDELSDVSQGGSK Predict reactive species Full Name: sperm associated antigen 9 Calculated Molecular Weight: 1321 aa, 146 kDa Observed Molecular Weight: 146 kDa GenBank Accession Number: BC146755 Gene Symbol: SPAG9 Gene ID (NCBI): 9043 RRID: AB_2879541 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60271 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.