Proteintech, 24425-1-AP, PCMTD1 Polyclonal antibody

Size: 20ul / 150ul The PCMTD1 (24425-1-AP) by Proteintech is a Polyclonal antibody targeting PCMTD1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 24425-1-AP targets PCMTD1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat liver tissue, human placenta tissue, hTERT-RPE1 cells, mouse eye tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Protein-l-isoaspartate O-methyltransferase domain-containing protein 1 (PCMTD1) is a putative E3 ubiquitin ligase substrate adaptor protein, which has a C-terminal domain containing SOCS-box ubiquitin ligase recruitment motifs. PCMTD1 protein may provide an alternate maintenance pathway for modified proteins in mammalian cells (PMID: 35486881). This antibody can detect two isoforms of PCMTD1, 27 kDa and 41 kDa respectively (PMID: 37953789, 35486881). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19634 Product name: Recombinant human PCMTD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-357 aa of BC032670 Sequence: IYIRRTLRNFINDEMQAKGIPQRAPPKRKRKRVKQRINTYVFVGNQLIPQPLDSEEDEKMEEDIKEEEEKDHNEAMKPEEPPQNLLREKIMKLPLPESLKAYLTYFRDK Predict reactive species Full Name: protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 1 Calculated Molecular Weight: 357 aa, 41 kDa Observed Molecular Weight: 41 kDa, 27 kDa GenBank Accession Number: BC032670 Gene Symbol: PCMTD1 Gene ID (NCBI): 115294 RRID: AB_3669436 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96MG8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.