Proteintech, 24429-1-AP, TEX38 Polyclonal antibody

Size: 20ul / 150ul The TEX38 (24429-1-AP) by Proteintech is a Polyclonal antibody targeting TEX38 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24429-1-AP targets TEX38 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, MDA-MB-453s cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TEX38, also named as ATPAF1-AS1 and C1orf223, is ATPAF1 antisense gene protein 1. This antibody detects 25-28 kDa with mouse testis and MDA-MB-453s cell lysate. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19833 Product name: Recombinant human C1orf223 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 43-226 aa of BC126318 Sequence: LCSVITGGCIIFLHWRKNLRREEHAQQWVEVMRAATFTYSPLLYWINKRRRYGMNAAINTGPAPAVTKTETEVQNPDVLWDLDIPEGRSHADQDSNPKAEAPAPLQPALQLAPQQPQARSPFPLPIFQEVPFAPPLCNLPPLLNHSVSYPLATCPERNVLFHSLLNLAQEDHSFNAKPFPSEL Predict reactive species Full Name: chromosome 1 open reading frame 223 Calculated Molecular Weight: 206 aa, 23 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC126318 Gene Symbol: TEX38 Gene ID (NCBI): 374973 RRID: AB_2879544 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PEX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.