Iright
BRAND / VENDOR: Proteintech

Proteintech, 24430-1-AP, RS1 Polyclonal antibody

CATALOG NUMBER: 24430-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RS1 (24430-1-AP) by Proteintech is a Polyclonal antibody targeting RS1 in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples 24430-1-AP targets RS1 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat retina tissue, mouse eye tissue Positive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse eye tissue Positive IF-Fro detected in: mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information RS1 is also named as XLRS1. RS1 can bind negatively charged membrane lipids, such as phosphatidylserine and phosphoinositides. RS1 is required for normal structure and function of the retina (PMID:19093009). It may play a role in cell-cell adhesion processes in the retina (PMID:27114531). RS1 is high expression in the retina (at protein level) (PMID:10915776, PMID:9326935). It is detected in the inner segment of the photoreceptors, the inner nuclear layer, the inner plexiform layer and the ganglion cell layer. At the macula, it is expressed in both the outer and inner nuclear layers and in the inner plexiform layer (PMID:10915776, PMID:10915776). And RS1 is undetectable in the inner plexiform layers and the inner nuclear layer (PMID:10915776) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18885 Product name: Recombinant human RS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-224 aa of BC141638 Sequence: TEDEGEDPWYQKACKCDCQGGPNALWSAGATSLDCIPECPYHKPLGFESGEVTPDQITCSNPEQYVGWYSSWTANKARLNSQGFGCAWLSKFQDSSQWLQIDLKEIKVISGILTQGRCDIDEWMTKYSVQYRTDERLNWIYYKDQTGNNRVFYGNSDRTSTVQNLLRPPIISRFIRLIPLGWHVRIAIRMELLECVSKCA Predict reactive species Full Name: retinoschisin 1 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC141638 Gene Symbol: RS1 Gene ID (NCBI): 6247 RRID: AB_2879545 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15537 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924