Iright
BRAND / VENDOR: Proteintech

Proteintech, 24444-1-AP, CHSY3 Polyclonal antibody

CATALOG NUMBER: 24444-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHSY3 (24444-1-AP) by Proteintech is a Polyclonal antibody targeting CHSY3 in WB, ELISA applications with reactivity to human samples 24444-1-AP targets CHSY3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information CHSY3 is a Golgi-localized chondroitin sulfate synthase that controls glycosaminoglycan chain elongation on extracellular matrix proteoglycans. By regulating chondroitin sulfate structure, CHSY3 influences matrix organization, growth factor signaling, and tissue mechanics. Its dysregulation is implicated in cartilage pathology, pulmonary remodeling, and cancer progression, highlighting CHSY3 as a key enzymatic regulator of extracellular matrix biology. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19641 Product name: Recombinant human CHSY3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 571-769 aa of BC137325 Sequence: FFRETEELDVNSLVESINSETQSFSFISNSLKILSSFQGAKEMGGHNEKKVHILVPLIGRYDIFLRFMENFENMCLIPKQNVKLVIILFSRDSGQDSSKHIELIKGYQNKYPKAEMTLIPMKGEFSRGLGLEMASAQFDNDTLLLFCDVDLIFREDFLQRCRDNTIQGQQVYYPIIFSQYDPKVTNGGNPPTDDYFIFS Predict reactive species Full Name: chondroitin sulfate synthase 3 Calculated Molecular Weight: 882 aa, 100 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC137325 Gene Symbol: CHSY3 Gene ID (NCBI): 337876 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q70JA7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924