Iright
BRAND / VENDOR: Proteintech

Proteintech, 24467-1-AP, FAM47B Polyclonal antibody

CATALOG NUMBER: 24467-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM47B (24467-1-AP) by Proteintech is a Polyclonal antibody targeting FAM47B in WB, ELISA applications with reactivity to human, mouse, rat samples 24467-1-AP targets FAM47B in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information FAM47B(Family with sequence similarity 47 member B) belongs to the FAM47 family and is expressed in testis. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21562 Product name: Recombinant human FAM47B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 308-412 aa of BC035026 Sequence: RPEPSKTQVSSLCPEPPEAGVSHLCLEPPNTHRVSSFLLQVLKLDSEKKLEDARARCEGQEMTTEELTKPGKYHFWESCPRPFESRMPHLRLVLPITRRMASLCL Predict reactive species Full Name: family with sequence similarity 47, member B Calculated Molecular Weight: 645 aa, 74 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC035026 Gene Symbol: FAM47B Gene ID (NCBI): 170062 RRID: AB_3669438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NA70 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924