Iright
BRAND / VENDOR: Proteintech

Proteintech, 24477-1-AP, TMEM194A Polyclonal antibody

CATALOG NUMBER: 24477-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMEM194A (24477-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM194A in WB, ELISA applications with reactivity to human, mouse samples 24477-1-AP targets TMEM194A in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21614 Product name: Recombinant human TMEM194A protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 224-371 aa of BC126300 Sequence: QIPHIALAIIIIALCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTEEEYRIQGEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSIIAQDEIYEEASSEEEDSYSRCPAITQNNFLT Predict reactive species Full Name: transmembrane protein 194A Calculated Molecular Weight: 444 aa, 51 kDa Observed Molecular Weight: 40-42 kDa, 50-55 kDa GenBank Accession Number: BC126300 Gene Symbol: TMEM194A Gene ID (NCBI): 23306 RRID: AB_2879561 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14524 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924