Iright
BRAND / VENDOR: Proteintech

Proteintech, 24478-1-AP, OPN4 Polyclonal antibody

CATALOG NUMBER: 24478-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OPN4 (24478-1-AP) by Proteintech is a Polyclonal antibody targeting OPN4 in IF-P, ELISA applications with reactivity to human, mouse samples 24478-1-AP targets OPN4 in IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IF-P detected in: mouse eye tissue Recommended dilution Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information OPN4, an opsin that was first isolated from the skin of Xenopus laevis in 1998, belongs not to the vertebrate-type opsin family but rather to the invertebrate-type opsins, which are part of the seven-transmembrane G protein-coupled receptor (GPCR) family (PMID:31989708). In humans, OPN4 is expressed in the retinal ganglion cells in addition to part of the brain (PMID:10632589). Moreover, Opn4 functions as a photoreceptor by detecting brightness levels and discriminating visual signals (PMID:22633808). Opn4 also facilitates visual circuits to acquire optimal settings and light adaptation by measuring irradiance levels (PMID:25517373). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21643 Product name: Recombinant human OPN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 356-478 aa of BC113558 Sequence: KYRVAIAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGWTHMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM Predict reactive species Full Name: opsin 4 Calculated Molecular Weight: 478 aa, 53 kDa GenBank Accession Number: BC113558 Gene Symbol: OPN4 Gene ID (NCBI): 94233 RRID: AB_3085736 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UHM6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924