Iright
BRAND / VENDOR: Proteintech

Proteintech, 24480-1-AP, PRPF39 Polyclonal antibody

CATALOG NUMBER: 24480-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRPF39 (24480-1-AP) by Proteintech is a Polyclonal antibody targeting PRPF39 in WB, IHC, ELISA applications with reactivity to human samples 24480-1-AP targets PRPF39 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, COLO 320 cells, Raji cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information PRPF39 also termed as Pre mRNA processing factor 39 or PRP39 homolog is a 669 amino acid protein, which contains 7 HAT repeats and belongs to the PRP39 family. PRPF39 localizes in nucleus and may play a role in mRNA splicing. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21683 Product name: Recombinant human PRPF39 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-348 aa of BC125126 Sequence: MEQSPDDSPNVNASTEETEMASAVDLPVTLTETEANFPPEYEKFWKTVENNPQDFTGWVYLLQYVEQENHLMAARKAFDRFFIHYPYCYGYWKKYADLEKRHDNIKPSDEVYRRGLQAIPLSVDLWIHYINFLKETLDPGDPETNNTIRGTFEHAVLAAGTDFRSDRLWEMYINWENEQGNLREVTAIYDRILGIPTQLYSHHFQRFKEHVQNNLPRDLLTGEQFIQLRRELASVNGHSGDDGPPGDDLPSGIEDITDPAKLITEIENMRHRIIEIHQEMFNYNEHEVSKRWTFEEGIKRPYFHVKPLEKAQLKNWKEYLEFEIENGTHERVVVLFERCVISCALYEE Predict reactive species Full Name: PRP39 pre-mRNA processing factor 39 homolog (S. cerevisiae) Calculated Molecular Weight: 669 aa, 78 kDa Observed Molecular Weight: 75-85 kDa GenBank Accession Number: BC125126 Gene Symbol: PRPF39 Gene ID (NCBI): 55015 RRID: AB_2879563 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86UA1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924