Iright
BRAND / VENDOR: Proteintech

Proteintech, 24484-1-AP, AMZ1 Polyclonal antibody

CATALOG NUMBER: 24484-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AMZ1 (24484-1-AP) by Proteintech is a Polyclonal antibody targeting AMZ1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 24484-1-AP targets AMZ1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse brain tissue, rat brain tissue Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information AMZ1, also named as KIAA1950, is a new human Zinc metalloproteases. It exhibits aminopeptidase activity against neurogranin in vitro. AMZ1 does not hydrolyze angiotensin-2. It is mainly detected in liver and heart. AMZ1 has some isoforms with MW 55 kDa, 33 kDa, 30 kDa and 28 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20248 Product name: Recombinant human AMZ1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 149-498 aa of BC146753 Sequence: DSDRLQLHTDGILSFLKNNKPGDALCVLGLTLSDLYPHEAWSFTFSKFLPGHEVGVCSFARFSGEFPKSGPSAPDLALVEAAADGPEAPLQDRGWALCFSALGMVQCCKVTCHELCHLLGLGNCRWLRCLMQGALSLDEALRRPLDLCPICLRKLQHVLGFRLIERYQRLYTWTQAVVGTWPSQEAGEPSVWEDTPPASADSGMCCESDSEPGTSVSEPLTPDAGSHTFASGPEEGLSYLAASEAPLPPGGPAEAIKEHERWLAMCIQALQREVAEEDLVQVDRAVDALDRWEMFTGQLPATRQDPPSSRDSVGLRKVLGDKFSSLRRKLSARKLARAESAPRPWDGEES Predict reactive species Full Name: archaelysin family metallopeptidase 1 Calculated Molecular Weight: 498 aa, 55 kDa Observed Molecular Weight: 33 kDa, 28 kDa GenBank Accession Number: BC146753 Gene Symbol: AMZ1 Gene ID (NCBI): 155185 RRID: AB_2879565 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q400G9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924