Proteintech, 24486-1-AP, OTUD6A Polyclonal antibody

Size: 20ul / 150ul The OTUD6A (24486-1-AP) by Proteintech is a Polyclonal antibody targeting OTUD6A in WB, IF/ICC, ELISA applications with reactivity to human samples 24486-1-AP targets OTUD6A in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21639 Product name: Recombinant human OTUD6A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC137356 Sequence: MDDPKSEQQRILRRHQRERQELQAQIRSLKNSVPKTDKTKRKQLLQDVARMEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRERMESEERERQESIFQAEMSEHLAGFKREEEEKLAAILGARGLEMKAI Predict reactive species Full Name: OTU domain containing 6A Calculated Molecular Weight: 288 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC137356 Gene Symbol: OTUD6A Gene ID (NCBI): 139562 RRID: AB_2879567 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7L8S5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.