Iright
BRAND / VENDOR: Proteintech

Proteintech, 24489-1-AP, E2F7 Polyclonal antibody

CATALOG NUMBER: 24489-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The E2F7 (24489-1-AP) by Proteintech is a Polyclonal antibody targeting E2F7 in WB, ELISA applications with reactivity to human samples 24489-1-AP targets E2F7 in WB, IHC, IF, CoIP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information E2F7, also named E2F transcription factor 7, is a 911 amino acid protein belonging to the E2F/DP family. E2F7 localizes in the nucleus and mainly forms homodimers and, to a lesser extent, heterodimers with E2F8. E2F7 as a transcription factor involves in various processes such as angiogenesis, polyploidization of specialized cells, and DNA damage response. E2F7 mainly forms homodimers and to a lesser extent, heterodimers with E2F8. (PMID: 18194653 ) Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21599 Product name: Recombinant human E2F7 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 369-713 aa of BC136366 Sequence: VDFSSSDEELVDVSASVLPELKRETYGQIQVCAKQKLARHGSFNTVQASERIQRKVNSEPSSPYREEQGSGGYSLEIGSLAAVYRQKIEDNSQGKAFASKRVVPPSSSLDPVAPFPVLSVDPEYCVNPLAHPVFSVAQTDLQAFSMQNGLNGQVDVSLASAASAVESLKPALLAGQPLVYVPSASLFMLYGSLQEGPASGSGSERDDRSSEAPATVELSSAPSAQKRLCEERKPQEEDEPATKRQSREYEDGPLSLVMPKKPSDSTDLASPKTMGNRASIPLKDIHVNGQLPAAEEISGKATANSLVSSEWGNPSRNTDVEKPSKENESTKEPSLLQYLCVQSPA Predict reactive species Full Name: E2F transcription factor 7 Calculated Molecular Weight: 911 aa, 100 kDa Observed Molecular Weight: ~100 kDa GenBank Accession Number: BC136366 Gene Symbol: E2F7 Gene ID (NCBI): 144455 RRID: AB_2879569 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96AV8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924