Proteintech, 24499-1-AP, ARID4B Polyclonal antibody

Size: 20ul / 150ul The ARID4B (24499-1-AP) by Proteintech is a Polyclonal antibody targeting ARID4B in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 24499-1-AP targets ARID4B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, A549 cells, K-562 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: human pancreas cancer tissue, human breast cancer tissue, human cervical cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ARID4B, also named as BRCAA1 or SAP180, is a 1312 amino acid protein, which contains one ARID domain. ARID4B localizes in the nucleus and cytoplasm. ARID4B as a transcription repressor may function in the assembly and/or enzymatic activity of the Sin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. ARID4B is highly expressed in the testis and in breast, lung, colon, pancreatic and ovarian cancers. Expressed at low levels in the thymus, prostate and ovary. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21462 Product name: Recombinant human ARID4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 406-523 aa of BC130418 Sequence: MALPEKVVNKQCKECENVKEIKVKEENETEIKEIKMEEERNIIPREEKPIEDEIERKENIKPSLGSKKNLLESIPTHSDQEKEVNIKKPEDNENLDDKDDDTTRVDESLNIKVEAEEE Predict reactive species Full Name: AT rich interactive domain 4B (RBP1-like) Calculated Molecular Weight: 1312 aa, 148 kDa Observed Molecular Weight: 100 kDa, 200 kDa GenBank Accession Number: BC130418 Gene Symbol: ARID4B Gene ID (NCBI): 51742 RRID: AB_2879575 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q4LE39 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.