Proteintech, 24526-1-AP, TRIM40 Polyclonal antibody

Size: 20ul / 150ul The TRIM40 (24526-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM40 in WB, ELISA applications with reactivity to mouse, rat samples 24526-1-AP targets TRIM40 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21649 Product name: Recombinant human TRIM40 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-258 aa of BC060785 Sequence: MIPLQKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASASGVFCCPLCRKPCSEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHMSHHELTIENALSHYKERLNRRSRKLRKDIAELQRLKAQQEKKLQALQFQVDHGNHRLEAGPESQHQTREQLGALPQQWLGQLEHMPAEAARILDISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLEKGVSELLLQPPQKL Predict reactive species Full Name: tripartite motif-containing 40 Calculated Molecular Weight: 258 aa, 29 kDa Observed Molecular Weight: 29-35 kDa GenBank Accession Number: BC060785 Gene Symbol: TRIM40 Gene ID (NCBI): 135644 RRID: AB_3669440 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P9F5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.