Proteintech, 24537-1-AP, C10orf125 Polyclonal antibody

Size: 20ul / 150ul The C10orf125 (24537-1-AP) by Proteintech is a Polyclonal antibody targeting C10orf125 in IHC, ELISA applications with reactivity to human samples 24537-1-AP targets C10orf125 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21689 Product name: Recombinant human C10orf125 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-134 aa of BC129819 Sequence: MVALKGVPALLSPELLYALARMGHGDEIVLADLNFPASSICQCGPMEIRADGLGIPQLLEAVLKLLPLDTYVESPAAVMELVPSDKERGLQTPVWTEYESILRRAGCVRALAKIERFEFYERAKKAFAVVATGC Predict reactive species Full Name: chromosome 10 open reading frame 125 Calculated Molecular Weight: 154 aa, 17 kDa GenBank Accession Number: BC129819 Gene Symbol: C10orf125 Gene ID (NCBI): 282969 RRID: AB_2879595 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A2VDF0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.