Iright
BRAND / VENDOR: Proteintech

Proteintech, 24561-1-AP, ZW10 Polyclonal antibody

CATALOG NUMBER: 24561-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZW10 (24561-1-AP) by Proteintech is a Polyclonal antibody targeting ZW10 in WB, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 24561-1-AP targets ZW10 in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, mouse testis tissue, K-562 cells, rat liver tissue, rat testis tissue Positive IP detected in: Jurkat cells Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information ZW10 is the human homolog of the Drosophila melanogaster Zw10 protein. ZW10 is localized to kinetochores and kinetochore-associated microtubules and is an essential component of the mitotic checkpoint, which prevents cells from prematurely exiting mitosis(PMID: 17102640). ZW10 proteins in Drosophila and HeLa cells display a similar and intriguing cell cycle-dependent intracellular distribution. ZW10 protein first becomes localized to the kinetochore at prometaphase, but then appears to move onto the kinetochore microtubules of the spindle at metaphase, and then back to the kinetochore at anaphase(PMID: 9700164). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19138 Product name: Recombinant human ZW10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 318-672 aa of BC128264 Sequence: NEKTSTVPLAEMLGDMIWEDLSECLIKNCLVYSIPTNSSKLQQYEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSEIHNTVKIIPDSKINVPELPTPDEDNKLEVQKVSNTQYHEVMNLEPENTLDQHSFSLPTCRISESVKKLMELAYQTLLEATTSSDQCAVQLFYSVRNIFHLFHDVVPTYHKENLQKLPQLAAIHHNNCMYIAHHLLTLGHQFRLRLAPILCDGTATFVDLVPGFRRLGTECFLAQMRAQKGELLERLSSARNFSNMDDEENYSAASKAVRQVLHQLKRLGIVWQDVLPVNIYCKAMGTLLNTAISEVIGKITALE Predict reactive species Full Name: ZW10, kinetochore associated, homolog (Drosophila) Calculated Molecular Weight: 779 aa, 89 kDa Observed Molecular Weight: 88-90 kDa GenBank Accession Number: BC128264 Gene Symbol: ZW10 Gene ID (NCBI): 9183 RRID: AB_2815001 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43264 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924