Proteintech, 24571-1-AP, LRRC18 Polyclonal antibody

Size: 20ul / 150ul The LRRC18 (24571-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC18 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 24571-1-AP targets LRRC18 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Leucine rich repeat containing protein 18 ( LRRC18 ) encodes a 261 amino-acids protein (29.6 kDa), which contains 7 leucine rich repeat and belongs to LRR superfamily. The function of protein is still non-known, but it may be involved in the regulation of spermatogenesis and sperm maturation. The protein localizes in cytoplasm and express in some male reproduction tissues. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20996 Product name: Recombinant human LRRC18 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-261 aa of BC036722 Sequence: MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVSTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSS Predict reactive species Full Name: leucine rich repeat containing 18 Calculated Molecular Weight: 261 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC036722 Gene Symbol: LRRC18 Gene ID (NCBI): 474354 RRID: AB_2879614 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N456 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.