Iright
BRAND / VENDOR: Proteintech

Proteintech, 24573-1-AP, NR2F1 Polyclonal antibody

CATALOG NUMBER: 24573-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NR2F1 (24573-1-AP) by Proteintech is a Polyclonal antibody targeting NR2F1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24573-1-AP targets NR2F1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, PC-3 cells, NIH/3T3 cells Positive IHC detected in: human stomach cancer tissue, human ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information NR2F1 (Nuclear receptor subfamily 2, group F, member 1), also known as COUP-TFI, is an orphan nuclear receptor belonging to the superfamily of steroid/thyroid hormone receptors and acting as a strong transcriptional regulator. NR2F1 has a DNA binding domain (DBD) consisting of two conserved Zinc-finger motifs and a ligand-binding domain (LBD). NR2F1 also plays an epigenetic role in mediating global histone modifications by interacting with or recruiting chromatin-remodeling enzymes. NR2F1 can be a biomarker of tumor dormancy that promotes quiescence of various types of cancer cells, including breast, prostate, and squamous cell carcinoma of the head and neck (PMID: 35740627). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0118 Product name: Recombinant human NR2F1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 178-421 aa of BC004154 Sequence: PLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQ Predict reactive species Full Name: nuclear receptor subfamily 2, group F, member 1 Calculated Molecular Weight: 50 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC004154 Gene Symbol: NR2F1 Gene ID (NCBI): 7025 RRID: AB_2879616 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10589 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924