Proteintech, 24580-1-AP, KCNQ3 Polyclonal antibody

Size: 20ul / 150ul The KCNQ3 (24580-1-AP) by Proteintech is a Polyclonal antibody targeting KCNQ3 in WB, ELISA applications with reactivity to human, mouse, rat samples 24580-1-AP targets KCNQ3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information KCNQ3, also named as BFNC2, EBN2 and KV7.3, belongs to the potassium channel family and KQT subfamily. KCNQ3 is probably important in the regulation of neuronal excitability. Associates with KCNQ2 or KCNQ5, KCNQ3 forms a potassium channel with essentially identical properties to the channel underlying the native M-current, a slowly activating and deactivating potassium conductance which plays a critical role in determining the subthreshold electrical excitability of neurons as well as the responsiveness to synaptic inputs. Defects in KCNQ3 are the cause of benign neonatal epilepsy type 2 (EBN2). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20147 Product name: Recombinant human KCNQ3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 379-517 aa of BC128576 Sequence: PNRIDLVATWRFYESVVSFPFFRKEQLEAASSQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKAYAFWQSSEDAGTGDPMAEDRGYGNDFPIEDMIPTLKAAIRAVRILQFR Predict reactive species Full Name: potassium voltage-gated channel, KQT-like subfamily, member 3 Calculated Molecular Weight: 872 aa, 97 kDa Observed Molecular Weight: ~90 kDa GenBank Accession Number: BC128576 Gene Symbol: KCNQ3 Gene ID (NCBI): 3786 RRID: AB_3085739 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43525 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.