Proteintech, 24582-1-AP, SLC37A1 Polyclonal antibody

Size: 20ul / 150ul The SLC37A1 (24582-1-AP) by Proteintech is a Polyclonal antibody targeting SLC37A1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 24582-1-AP targets SLC37A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, MCF-7 cells, rat kidney tissue Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SLC37A1 (also known as SPX1) is one of the SLC37 family members, localized in the endoplasmic reticulum (ER) membrane (PMID:29719821). The SLC37A1 protein also shares 30% sequence identity to GlpT, suggesting that SLC37A1 could be a mammalian glycerol-3-phosphate transporter. The SLC37A1 gene is widely expressed, with the highest transcript levels in adult kidney, bone marrow, intestine, spleen, and liver (PMID:24745989). In addition, the SLC37A1 protein shares 59% homology to SLC37A2, 35% homology to SLC37A3, and 22% homology to SLC37A4 (PMID:23506893). SLC37A1 is a 533 amino-acid protein with a calculated molecular weight of 58 kDa and observed molecular weight 60-66kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20180 Product name: Recombinant human SLC37A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 247-336 aa of BC152997 Sequence: DVRCSSTLVTHSKGYENGTNRLRLQKQILKSEKNKPLDPEMQCLLLSDGKGSIHPNHVVILPGDGGSGTAAISFTGALKIPGVIEFSLCL Predict reactive species Full Name: solute carrier family 37 (glycerol-3-phosphate transporter), member 1 Calculated Molecular Weight: 533 aa, 58 kDa Observed Molecular Weight: 60-66 kDa GenBank Accession Number: BC152997 Gene Symbol: SLC37A1 Gene ID (NCBI): 54020 RRID: AB_2879621 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P57057 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.